PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004379-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 184aa    MW: 21229.8 Da    PI: 7.5728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004379-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l +++  +G g W++ ar  g++Rt+k+c++rw++yl
    NNU_004379-RA 15 KGPWTMEEDLILMNYIGNHGEGEWNSLARSAGLKRTGKSCRLRWLNYL 62
                     79********************************************97 PP

2Myb_DNA-binding53.84.4e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
    NNU_004379-RA  68 RGNITAEEQLLIMELHARWGNR-WSKIAKHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-23865IPR009057Homeodomain-like
PROSITE profilePS5129416.1991062IPR017930Myb domain
SuperFamilySSF466891.01E-3012109IPR009057Homeodomain-like
SMARTSM007172.6E-111464IPR001005SANT/Myb domain
PfamPF002495.1E-151562IPR001005SANT/Myb domain
CDDcd001674.75E-81762No hitNo description
PROSITE profilePS5129424.91963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-2466117IPR009057Homeodomain-like
SMARTSM007174.1E-1567115IPR001005SANT/Myb domain
PfamPF002491.1E-1568111IPR001005SANT/Myb domain
CDDcd001675.04E-1172111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MDKKPGRSQE PEVRKGPWTM EEDLILMNYI GNHGEGEWNS LARSAGLKRT GKSCRLRWLN  60
YLKPDVRRGN ITAEEQLLIM ELHARWGNRW SKIAKHLPGR TDNEIKNYWR TKIRKHIKEA  120
ENNPSQSSEI NPEQTTSSQV SSDANAVEPC SPTYTGNLQE AWMGALPTES NDSFWSVEDL  180
WYMP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271111723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251229.11e-135PREDICTED: myb-related protein 340-like
SwissprotP813967e-88MYB40_ANTMA; Myb-related protein 340
TrEMBLA0A068U0Q22e-95A0A068U0Q2_COFCA; Uncharacterized protein
STRINGVIT_14s0066g01090.t015e-90(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.11e-75myb domain protein 24